Snacks

91 Pins
 17w
Pepper Jelly Cheese Dip - The Tipsy Housewife Stuffed Peppers, Cheese Dip, Pepper Jelly, Cream Cheese, Donna, Dining, Amazing
Pepper Jelly Cheese Dip - The Tipsy Housewife
Pepper Jelly Cheese Dip - The Tipsy Housewife
Cheesy Jalapeño Turkey Sliders Fried Rice, Paninis, Sandwiches, Jalapeno Poppers Baked, Deli Sandwiches, Panini, Jalapeno Poppers, Baked Sandwiches, Burgers Sandwiches
Jalapeño Popper Baked Turkey Sandwiches
Cheesy Jalapeño Turkey Sliders
·
35m
Delicious air fryer chickpeas that are super healthy, vegan and gluten-free snack. These are guilt free and very nutritious. Very easy to make in the Air fryer too. #airfryerhealthysnacks #airfryerchickpeas #airfryerchickpeasrecipes #airfryerchickpeasvegan #airfryerchickpeasweightwatchers #airfryerhealthyrecipes #airfryerIndianrecipes Healthy Recipes, Snacks, Raw Food Recipes, Air Fryer Recipes, Air Fryer Recipes Easy, Air Fryer Dinner Recipes, Chickpea, Whole Food Recipes, Veggies
Air fryer Chickpeas
Delicious air fryer chickpeas that are super healthy, vegan and gluten-free snack. These are guilt free and very nutritious. Very easy to make in the Air fryer too. #airfryerhealthysnacks #airfryerchickpeas #airfryerchickpeasrecipes #airfryerchickpeasvegan #airfryerchickpeasweightwatchers #airfryerhealthyrecipes #airfryerIndianrecipes
·
21m
Queso Dip is the ultimate party dip! It has all the cheesy goodness a great dip should have and loads of flavor from sausage and jalapeno! #ad #spendwithpennies #easyrecipe #easydip #creamydip #spicydip #cheesedip #withcheese #partydip #partyrecipe #appetizer #easyappetizer Sauces, Mexican Food Recipes, Salsa, Appetiser Recipes, Dips, Appetisers, Brunch, Appetizer Dips, Appetizer Recipes
Easy Queso Dip
Queso Dip is the ultimate party dip! It has all the cheesy goodness a great dip should have and loads of flavor from sausage and jalapeno! #ad #spendwithpennies #easyrecipe #easydip #creamydip #spicydip #cheesedip #withcheese #partydip #partyrecipe #appetizer #easyappetizer
My girlfriend brought these granola bars over for a playgroup one morning and ever since they've been a staple! Breakfast, Breads, Dessert, Pizzas, Muffin, Desserts, Cake
Playgroup Granola Bars
My girlfriend brought these granola bars over for a playgroup one morning and ever since they've been a staple!
·
50m
Cilantro and cayenne give this classic guacamole a tasty kick. Serve it smooth or chunky. Guacamole, Salads, Guacamole Recipe
Guacamole
Cilantro and cayenne give this classic guacamole a tasty kick. Serve it smooth or chunky.
·
15m
Oatmeal Peanut Butter Protein Balls are made with oats, peanut butter, honey, flaxseed, Rice Krispies, coconut oil and vanilla. These are healthy, filling and the tastiest protein ball recipe that I've ever tried! Protein, Clean Eating Snacks, Protein Bars, Nutrition, Peanut Butter Protein, Protein Balls Recipes, Protein Bites
OATMEAL PEANUT BUTTER PROTEIN BALLS
Oatmeal Peanut Butter Protein Balls are made with oats, peanut butter, honey, flaxseed, Rice Krispies, coconut oil and vanilla. These are healthy, filling and the tastiest protein ball recipe that I've ever tried!
Runner's Fuel Protein & Chia Seed Balls | Camp Makery Smoothies, Healthy Eating, Weight Watchers Desserts, Health Foods, Protein Snacks
Runner's Fuel Protein & Chia Seed Balls
Runner's Fuel Protein & Chia Seed Balls | Camp Makery
Chewy Honey Granola Bars Brownies, Chewy Granola Bars, Homemade Granola Bars, Honey Granola Bar Recipe, Homemade Granola, Cereal Bars
Chewy Honey Granola Bars
Chewy Honey Granola Bars
·
25m
Homemade Fruit Roll Ups: With 3 wholesome ingredients you can easily make homemade fruit leather. These easy 3 ingredient, healthy fruit roll ups are the perfect lunch box treat. #lunchbox #vegan #allergyfree #glutenfree via @amindfullmom Lunches, Fruit, Healthy Fruit Roll Up Recipe, Fruit Roll Ups Homemade, Fruit Roll Ups, Homemade Snacks, Fruit Snacks
Homemade Fruit Roll-Ups
Homemade Fruit Roll Ups: With 3 wholesome ingredients you can easily make homemade fruit leather. These easy 3 ingredient, healthy fruit roll ups are the perfect lunch box treat. #lunchbox #vegan #allergyfree #glutenfree via @amindfullmom
Edamame 5 Ways | - Tastes Better From Scratch Vegetable Recipes, Side Dishes, Shelled Edamame Recipe, Vegetable Side Dishes, Edamame Recipes, Edemame Recipes, Edamame Snack
Edamame 5 Ways
Edamame 5 Ways | - Tastes Better From Scratch
Oatmeal Peanut Butter Energy Bites with steel cut oats and flax seeds are the perfect healthy, grab-and-go snack for a busy day!  | tastesbetterfromscratch.com via @betrfromscratch Paleo, Healthy Snacks, Peanut Butter Energy Bites, Paleo Snacks, Energy Breakfast
Energy Balls
Oatmeal Peanut Butter Energy Bites with steel cut oats and flax seeds are the perfect healthy, grab-and-go snack for a busy day! | tastesbetterfromscratch.com via @betrfromscratch
EASY 5 Ingredient Peanut Butter Cup Chia Seed Energy Bites! #vegan #glutenfree #peanutbutter High Protein Snacks, Vegan Snacks, Healthy Protein, Healthy Protein Snacks, High Protein Snack Recipes
5-Ingredient Peanut Butter Cup Energy Bites
EASY 5 Ingredient Peanut Butter Cup Chia Seed Energy Bites! #vegan #glutenfree #peanutbutter
·
15m
Sweet Potato Banana Bites via @lclivingston Quinoa, Chia Seeds, Gluten Free, Gluten Free Sweet Potato, Sweet Potato
Sweet Potato Banana Muffins
Sweet Potato Banana Bites via @lclivingston
·
25m
Best+Guacamole+-+Allrecipes.com Avocado, Guacamole Dip, Guacamole Recipe Easy, Homemade Guacamole
Best Guacamole
Best+Guacamole+-+Allrecipes.com
·
1h 5m